Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKBKE Peptide - N-terminal region

IKBKE Peptide - N-terminal region

Product Specifications

Product Name Alternative

IKK-i, IKKE, IKKI, KIAA0151, MGC125294, MGC125295, MGC125297, IKK-E

UniProt

Q3B754

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IKBKE Rabbit Polyclonal Antibody (orb585557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001180250

Preservative

Lyophilized powder

AA Sequence

AGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myometrium
CS501082 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
NIRF (UHRF2) Human qPCR Primer Pair (NM_152896)
HP231151 200 Reactions

NIRF (UHRF2) Human qPCR Primer Pair (NM_152896)

Sign In for Pricing
View Details
CD2 Mouse Monoclonal Antibody [Clone ID: B-E2]
AM39007FC-N 100 Tests

CD2 Mouse Monoclonal Antibody [Clone ID: B-E2]

Sign In for Pricing
View Details
HC 030031
TRC-H115000-500MG 500 mg

HC 030031

Sign In for Pricing
View Details
Atp10d Mouse Gene Knockout Kit (CRISPR)
KN501758 1 Kit

Atp10d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chrna7 Mouse Gene Knockout Kit (CRISPR)
KN303310LP 1 Kit

Chrna7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details