Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKBKE Peptide - N-terminal region

IKBKE Peptide - N-terminal region

Product Specifications

Product Name Alternative

IKK-i, IKKE, IKKI, KIAA0151, MGC125294, MGC125295, MGC125297, IKK-E

UniProt

Q3B754

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IKBKE Rabbit Polyclonal Antibody (orb585557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001180250

Preservative

Lyophilized powder

AA Sequence

AGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKR (EIF2AK2) pThr451 Rabbit Polyclonal Antibody
AP02528PU-S 50 µL

PKR (EIF2AK2) pThr451 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ESSPL (PRSS48) activation kit by CRISPRa
GA117604 1 Kit

Human ESSPL (PRSS48) activation kit by CRISPRa

Sign In for Pricing
View Details
HSPA5 Polyclonal Antibody
E-AB-19292-01 20 µL

HSPA5 Polyclonal Antibody

Sign In for Pricing
View Details
HSPA5 Polyclonal Antibody
E-AB-19292-02 60 µL

HSPA5 Polyclonal Antibody

Sign In for Pricing
View Details
HSPA5 Polyclonal Antibody
E-AB-19292-03 120 µL

HSPA5 Polyclonal Antibody

Sign In for Pricing
View Details
HSPA5 Polyclonal Antibody
E-AB-19292-04 200 µL

HSPA5 Polyclonal Antibody

Sign In for Pricing
View Details