Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17A Peptide - N-terminal region

IL17A Peptide - N-terminal region

Product Specifications

Product Name Alternative

CTLA8, IL-17, IL-17A, IL17

UniProt

Q16552

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002181

Preservative

Lyophilized powder

AA Sequence

MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn2r54 shRNA (UAS) - Lentiviral mouse Vmn2r54 shRNA (UAS, iRFP) (25)
GTR15259910 1 Vial

Lentiviral mouse Vmn2r54 shRNA (UAS) - Lentiviral mouse Vmn2r54 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lox (NM_010728) Mouse Tagged ORF Clone Lentiviral Particle
MR206463L3V 200 µL

Lox (NM_010728) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ELAVL4 Rabbit pAb
A10655-01 20 µL

ELAVL4 Rabbit pAb

Sign In for Pricing
View Details
ELAVL4 Rabbit pAb
A10655-02 100 μL

ELAVL4 Rabbit pAb

Sign In for Pricing
View Details
ELAVL4 Rabbit pAb
A10655-03 500 μL

ELAVL4 Rabbit pAb

Sign In for Pricing
View Details
ELAVL4 Rabbit pAb
A10655-04 1000 μL

ELAVL4 Rabbit pAb

Sign In for Pricing
View Details