Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL18 Peptide - C-terminal region

IL18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IGIF, IL-18, IL-1g, IL1F4, MGC12320

UniProt

Q14116

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL18 Rabbit Polyclonal Antibody (orb584776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001553

Preservative

Lyophilized powder

AA Sequence

IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF647 conjugate, 0.1mg/mL
BNC472222-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
beta 1 Adrenergic Receptor (ADRB1) Human Gene Knockout Kit (CRISPR)
KN217134BN 1 Kit

beta 1 Adrenergic Receptor (ADRB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Foxf2 Mouse Gene Knockout Kit (CRISPR)
KN306079 1 Kit

Foxf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human PDGF-BB Protein
PKSH032906-01 10 µg

Recombinant Human PDGF-BB Protein

Sign In for Pricing
View Details
Recombinant Human PDGF-BB Protein
PKSH032906-02 50 µg

Recombinant Human PDGF-BB Protein

Sign In for Pricing
View Details
Vibrio cholerae TaqMan PCR Lyophilized Kits
TM38550L 100 Reactions

Vibrio cholerae TaqMan PCR Lyophilized Kits

Sign In for Pricing
View Details