Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL18 Peptide - C-terminal region

IL18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IGIF, IL-18, IL-1g, IL1F4, MGC12320

UniProt

Q14116

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL18 Rabbit Polyclonal Antibody (orb584776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001553

Preservative

Lyophilized powder

AA Sequence

IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EG215472 (NM_174999) Mouse Tagged ORF Clone
MG201659 10 µg

EG215472 (NM_174999) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
α, ω-Bis-Formylpentanamido PEG
112000-6.5G 5 g

α, ω-Bis-Formylpentanamido PEG

Sign In for Pricing
View Details
Nefl Rabbit Monoclonal Antibody [Clone ID: R04-7H3]
TA421561 100 µL

Nefl Rabbit Monoclonal Antibody [Clone ID: R04-7H3]

Sign In for Pricing
View Details
TECPR1 (N-term) Rabbit Polyclonal Antibody
AP17619PU-N 400 µL

TECPR1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GK5 (NM_001039547) Human Recombinant Protein
TP324409L 1 mg

GK5 (NM_001039547) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Tissue Factor Monoclonal Antibody
E-AB-81613-01 50 µL

Recombinant Tissue Factor Monoclonal Antibody

Sign In for Pricing
View Details