IL1RL2 Peptide - N-terminal region
IL1RL2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
IL1R-rp2, IL1RRP2
UniProt
Q9HB29
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL1RL2 Rabbit Polyclonal Antibody (orb579771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003845
Preservative
Lyophilized powder
AA Sequence
HVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![STAT4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F9]](https://cdn.genprice.uk/products/937/68dd1b6a061270361ea161bf/imageurl/ta503022bm.webp)
TA503022BM 100 µL
STAT4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F9]
Sign In for Pricing
View Details 
GP-6301-5 1 mL
Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-, 5nm
Sign In for Pricing
View Details 
PKSV030123 100 µg
Recombinant DENV (type 1, strain US/Hawaii/1944) E / Envelope Protein (Domain III, His Tag)
Sign In for Pricing
View Details 
BNC881800-500 1x 500 µL
HSV1 (Herpes Simplex Virus Type I) (N/A), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP305699M 100 µg
Epithelial Stromal Interaction 1 (EPSTI1) (NM_001002264) Human Recombinant Protein
Sign In for Pricing
View Details