Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RL2 Peptide - N-terminal region

IL1RL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IL1R-rp2, IL1RRP2

UniProt

Q9HB29

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL1RL2 Rabbit Polyclonal Antibody (orb579771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003845

Preservative

Lyophilized powder

AA Sequence

HVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP5 (NM_021572) Human Over-expression Lysate
LC402863 20 µg

ENPP5 (NM_021572) Human Over-expression Lysate

Sign In for Pricing
View Details
AGFG1 (NM_001135187) Human Over-expression Lysate
LY427581 100 µg

AGFG1 (NM_001135187) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Ucp1/Ucp3 Antibody
RC-15006-01 50 μL

Recombinant Ucp1/Ucp3 Antibody

Sign In for Pricing
View Details
Recombinant Ucp1/Ucp3 Antibody
RC-15006-02 100 µL

Recombinant Ucp1/Ucp3 Antibody

Sign In for Pricing
View Details
Recombinant Ucp1/Ucp3 Antibody
RC-15006-03 1 mL

Recombinant Ucp1/Ucp3 Antibody

Sign In for Pricing
View Details
C7orf59 (LAMTOR4) (NM_001008395) Human Recombinant Protein
TP309099L 1 mg

C7orf59 (LAMTOR4) (NM_001008395) Human Recombinant Protein

Sign In for Pricing
View Details