Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL27 Peptide - C-terminal region

IL27 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IL-27, IL-27A, IL27p28, IL30, MGC71873, p28, IL27A

UniProt

Q8NEV9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL27 Rabbit Polyclonal Antibody (orb584779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663634

Preservative

Lyophilized powder

AA Sequence

AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS45A (VPS45) (NM_007259) Human Recombinant Protein
TP306027M 100 µg

VPS45A (VPS45) (NM_007259) Human Recombinant Protein

Sign In for Pricing
View Details
Human SCD5 activation kit by CRISPRa
GA112761 1 Kit

Human SCD5 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) Mouse Monoclonal Antibody [Clone ID: SPM263]
AM50130PU-S 100 µg

Cytokeratin 14 (KRT14) Mouse Monoclonal Antibody [Clone ID: SPM263]

Sign In for Pricing
View Details
Calcein
TRC-C125413-1G 1 g

Calcein

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL
BNC682302-500 1x 500 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ent-Mavacamten
TRC-M299820-50MG 50 mg

Ent-Mavacamten

Sign In for Pricing
View Details