Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL27 Peptide - C-terminal region

IL27 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IL-27, IL-27A, IL27p28, IL30, MGC71873, p28, IL27A

UniProt

Q8NEV9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL27 Rabbit Polyclonal Antibody (orb584779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663634

Preservative

Lyophilized powder

AA Sequence

AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), 1mg/mL
BNUM1373-50 1x 50 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS507354 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
UROD (NM_000374) Human Over-expression Lysate
LY424758 100 µg

UROD (NM_000374) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992E-01 50 Tests

APC Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
APC Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992E-02 100 Tests

APC Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
APC Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992E-03 2x 100 Tests

APC Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details