Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ilf3 Peptide - C-terminal region

Ilf3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPHOSPH4, NF90

UniProt

Q9Z1X4

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ilf3 Rabbit Polyclonal Antibody (orb574001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034691

Preservative

Lyophilized powder

AA Sequence

YQGDSYNSPVPPKHAGKKPLHGGQQKASYSSGYQSHQGQQQPYNQSQYSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl N-Boc-piperidine-4-carboxylate
TRC-E925260-5G 5 g

Ethyl N-Boc-piperidine-4-carboxylate

Sign In for Pricing
View Details
Teduglutide Trifluoroacetic Acid Salt
TRC-T138000-5MG 5 mg

Teduglutide Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to FITC,  5nm
GM-502-5 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to FITC, 5nm

Sign In for Pricing
View Details
7-bromohept-1-yne
TRC-B758285-10MG 10 mg

7-bromohept-1-yne

Sign In for Pricing
View Details
RAB24 Rabbit Polyclonal Antibody
TA360856 100 µL

RAB24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF488A conjugate, 0.1mg/mL
BNC882304-500 1x 500 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details