Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ilf3 Peptide - C-terminal region

Ilf3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPHOSPH4, NF90

UniProt

Q9Z1X4

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ilf3 Rabbit Polyclonal Antibody (orb574001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034691

Preservative

Lyophilized powder

AA Sequence

YQGDSYNSPVPPKHAGKKPLHGGQQKASYSSGYQSHQGQQQPYNQSQYSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vegfa Mouse Monoclonal Antibody [Clone ID: CH-10]
TA420157 0.1 mg

Vegfa Mouse Monoclonal Antibody [Clone ID: CH-10]

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2115), CF640R conjugate, 0.1mg/mL
BNC402115-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF740 conjugate, 0.1mg/mL
BNC742445-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IL-1 beta Recombinant Rabbit monoclonal Antibody
HA722625B 100 µL

Mouse IL-1 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Bulk Anti-Myc Tag (9E10) Antibody
ICH1213-20mg 20 mg

Bulk Anti-Myc Tag (9E10) Antibody

Sign In for Pricing
View Details
L-Alanyl-L-alanyl-L-alanine
TRC-A576393-500MG 500 mg

L-Alanyl-L-alanyl-L-alanine

Sign In for Pricing
View Details