Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING2 Peptide - N-terminal region

ING2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ING1L, p33ING2

UniProt

Q9H160

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ING2 Rabbit Polyclonal Antibody (orb581101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001555

Preservative

Lyophilized powder

AA Sequence

TCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Synaptophysin Antibody [Alexa Fluor 750]
NBP2-25170AF750 0.1 mL

Rabbit Polyclonal Synaptophysin Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
PNMT (Phenylethanolamine N Methyltransferase) (Not for Export EU)
P4350-06 50 µL

PNMT (Phenylethanolamine N Methyltransferase) (Not for Export EU)

Sign In for Pricing
View Details
COQ10B CRISPR Knock Out 293T Cell Line (Human)
16641141 1x 10^6 Cells / 1.0 mL

COQ10B CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
FCG2A (Low Affinity Immunoglobulin Gamma Fc Region Receptor II-a, Fc Fragment of IgG Receptor IIa)
480961 100 µL

FCG2A (Low Affinity Immunoglobulin Gamma Fc Region Receptor II-a, Fc Fragment of IgG Receptor IIa)

Sign In for Pricing
View Details
Bovine Zinc finger FYVE domain-containing protein 26, ZFYVE26 ELISA Kit
MBS9325496-01 48 Well

Bovine Zinc finger FYVE domain-containing protein 26, ZFYVE26 ELISA Kit

Sign In for Pricing
View Details
Bovine Zinc finger FYVE domain-containing protein 26, ZFYVE26 ELISA Kit
MBS9325496-02 96 Well

Bovine Zinc finger FYVE domain-containing protein 26, ZFYVE26 ELISA Kit

Sign In for Pricing
View Details