Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING2 Peptide - N-terminal region

ING2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ING1L, p33ING2

UniProt

Q9H160

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ING2 Rabbit Polyclonal Antibody (orb581101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001555

Preservative

Lyophilized powder

AA Sequence

TCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human alpha-Synuclein (A30P/A53T) protein
SNA2004-100 100 µg

Recombinant human alpha-Synuclein (A30P/A53T) protein

Sign In for Pricing
View Details
DGKA Polyclonal Antibody
E913969 100 µL

DGKA Polyclonal Antibody

Sign In for Pricing
View Details
IL-15Rα (G-7)
sc-271366 200 µg/mL

IL-15Rα (G-7)

Sign In for Pricing
View Details
Mouse Pcdha10 Pre-designed siRNA Set A
SI110192A 1 Each

Mouse Pcdha10 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anks4b 3'UTR GFP Stable Cell Line
TU151859 1.0 mL

Anks4b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse B7-2/CD86 Alexa Fluor 405 Antibody (Clone GL1)
FAB741V-100UG 100 µg

Mouse B7-2/CD86 Alexa Fluor 405 Antibody (Clone GL1)

Sign In for Pricing
View Details