Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5D Peptide - C-terminal region

INPP5D Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC104855, MGC142140, MGC142142, SHIP, SHIP1, SIP-145, hp51CN

UniProt

Q92835

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5D Rabbit Polyclonal Antibody (orb584877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017915

Preservative

Lyophilized powder

AA Sequence

PPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Perforin Antibody (BOR21)
NBP1-43106-0.1mg 0.1 mg

Mouse Monoclonal Perforin Antibody (BOR21)

Sign In for Pricing
View Details
Anti-DHX36 Antibody Picoband® Cy3 Conjugated
A04923-2-Cy3 100 µg/Vial

Anti-DHX36 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Mouse TAS2R109 shRNA Plasmid
abx983942-01 150 µg

Mouse TAS2R109 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TAS2R109 shRNA Plasmid
abx983942-02 300 µg

Mouse TAS2R109 shRNA Plasmid

Sign In for Pricing
View Details
BCN-Osu
JH918946 1 Each

BCN-Osu

Sign In for Pricing
View Details
PRMT7 Rabbit Polyclonal Antibody (Biotin)
orb2586799 100 µg

PRMT7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details