Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5K Peptide - C-terminal region

INPP5K Peptide - C-terminal region

Product Specifications

Product Name Alternative

PPS, SKIP

UniProt

Q9BT40

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5K Rabbit Polyclonal Antibody (orb584915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057616

Preservative

Lyophilized powder

AA Sequence

PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDCN (Podocin) CLIA Kit
MBS2533158-01 96 Tests

Human PDCN (Podocin) CLIA Kit

Sign In for Pricing
View Details
Human PDCN (Podocin) CLIA Kit
MBS2533158-02 5x 96 Tests

Human PDCN (Podocin) CLIA Kit

Sign In for Pricing
View Details
HSPE1 Antibody
E51A00560 100 µL

HSPE1 Antibody

Sign In for Pricing
View Details
LRRC3 (NM_030891) Human Over-expression Lysate
LH12415V 100 µg

LRRC3 (NM_030891) Human Over-expression Lysate

Sign In for Pricing
View Details
Compound Fr12982
Fr12982-01 100 mg

Compound Fr12982

Sign In for Pricing
View Details
Compound Fr12982
Fr12982-02 2 mg

Compound Fr12982

Sign In for Pricing
View Details