Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5K Peptide - C-terminal region

INPP5K Peptide - C-terminal region

Product Specifications

Product Name Alternative

PPS, SKIP

UniProt

Q9BT40

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5K Rabbit Polyclonal Antibody (orb584915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057616

Preservative

Lyophilized powder

AA Sequence

PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF488A conjugate, 0.1mg/mL
BNC882137-500 1x 500 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRG2 Protein Vector (Rat) (pPB-C-His)
PV295994 500 ng

PRG2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
RSU1 Polyclonal Antibody
E55A02351 100 µg

RSU1 Polyclonal Antibody

Sign In for Pricing
View Details
ATP5I Antibody
orb125464-01 25 µg

ATP5I Antibody

Sign In for Pricing
View Details
ATP5I Antibody
orb125464-02 50 µg

ATP5I Antibody

Sign In for Pricing
View Details
ATP5I Antibody
orb125464-03 100 µg

ATP5I Antibody

Sign In for Pricing
View Details