Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL5 Peptide - middle region

INSL5 Peptide - middle region

Product Specifications

Product Name Alternative

MGC126695, MGC126697, PRO182, UNQ156

UniProt

Q9Y5Q6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INSL5 Rabbit Polyclonal Antibody (orb581559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005469

Preservative

Lyophilized powder

AA Sequence

RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cxcr3 Mouse Gene Knockout Kit (CRISPR)
KN304051 1 Kit

Cxcr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ELP2 Polyclonal Antibody
E-AB-14722-01 20 µL

ELP2 Polyclonal Antibody

Sign In for Pricing
View Details
ELP2 Polyclonal Antibody
E-AB-14722-02 60 µL

ELP2 Polyclonal Antibody

Sign In for Pricing
View Details
ELP2 Polyclonal Antibody
E-AB-14722-03 120 µL

ELP2 Polyclonal Antibody

Sign In for Pricing
View Details
ELP2 Polyclonal Antibody
E-AB-14722-04 200 µL

ELP2 Polyclonal Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803J-01 25 µg

PerCP/Cyanine5.5 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details