Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL5 Peptide - middle region

INSL5 Peptide - middle region

Product Specifications

Product Name Alternative

MGC126695, MGC126697, PRO182, UNQ156

UniProt

Q9Y5Q6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INSL5 Rabbit Polyclonal Antibody (orb581559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005469

Preservative

Lyophilized powder

AA Sequence

RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 610 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121T-01 50 Tests

Elab Fluor® Violet 610 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121T-02 100 Tests

Elab Fluor® Violet 610 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121T-03 2x 100 Tests

Elab Fluor® Violet 610 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
RPA14 (RPA3) (NM_002947) Human Over-expression Lysate
LY401032 100 µg

RPA14 (RPA3) (NM_002947) Human Over-expression Lysate

Sign In for Pricing
View Details
Variable Volume Single Channel Micropipette BPIP-505
BPIP-505 1 Unit

Variable Volume Single Channel Micropipette BPIP-505

Sign In for Pricing
View Details
LGALS1 Antibody
KC-877-01 50 μL

LGALS1 Antibody

Sign In for Pricing
View Details