Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insr Peptide - middle region

Insr Peptide - middle region

Product Specifications

Product Name Alternative

4932439J01Rik, CD220, D630014A15Rik, IR, IR-A, IR-B

UniProt

P15208

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Insr Rabbit Polyclonal Antibody (orb578024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034698

Preservative

Lyophilized powder

AA Sequence

EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gentianose
TRC-G362503-1MG 1 mg

Gentianose

Sign In for Pricing
View Details
PD-L1 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-43073R-APC-Cy5.5 100 µL

PD-L1 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
TANK Polyclonal Antibody, PerCP Conjugated
bs-1355R-PerCP 100 µL

TANK Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Wars2 ORF Vector (Rat) (pORF)
50252016 1.0 µg DNA

Wars2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CSTF1 Protein Vector (Human) (pPM-C-HA)
PV010999 500 ng

CSTF1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SGC 6870N
MBS5798356 Inquire

SGC 6870N

Sign In for Pricing
View Details