Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK2 Peptide - C-terminal region

IRAK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IRAK-2, MGC150550

UniProt

O43187

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRAK2 Rabbit Polyclonal Antibody (orb584937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001561

Preservative

Lyophilized powder

AA Sequence

SSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: right
CR560861 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
Cathepsin D (CTSD) Rabbit Polyclonal Antibody
AP20767PU-N 100 µg

Cathepsin D (CTSD) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D-Homocitrulline
TRC-H590903-250MG 250 mg

D-Homocitrulline

Sign In for Pricing
View Details
Automatic Polarimeter BPOL-104
BPOL-104 1 Unit

Automatic Polarimeter BPOL-104

Sign In for Pricing
View Details
ADCY4 Antibody
8C12034-AAT 50 µg

ADCY4 Antibody

Sign In for Pricing
View Details
Sanbr Mouse Gene Knockout Kit (CRISPR)
KN500004 1 Kit

Sanbr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details