Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK4 Peptide - C-terminal region

IRAK4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IPD1, NY-REN-64, REN64, IRAK-4

UniProt

Q9NWZ3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRAK4 Rabbit Polyclonal Antibody (orb585023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138728

Preservative

Lyophilized powder

AA Sequence

TGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf27 (NM_001039140) Human Over-expression Lysate
LY422021 100 µg

C20orf27 (NM_001039140) Human Over-expression Lysate

Sign In for Pricing
View Details
BAX Antibody
KC-628-01 50 μL

BAX Antibody

Sign In for Pricing
View Details
BAX Antibody
KC-628-02 100 µL

BAX Antibody

Sign In for Pricing
View Details
BAX Antibody
KC-628-03 1 mL

BAX Antibody

Sign In for Pricing
View Details
ODC1 Antibody
KC-7710-01 50 μL

ODC1 Antibody

Sign In for Pricing
View Details
ODC1 Antibody
KC-7710-02 100 µL

ODC1 Antibody

Sign In for Pricing
View Details