Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK4 Peptide - C-terminal region

IRAK4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IPD1, NY-REN-64, REN64, IRAK-4

UniProt

Q9NWZ3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRAK4 Rabbit Polyclonal Antibody (orb585023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138728

Preservative

Lyophilized powder

AA Sequence

TGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1CL1 (AKR1C8P) (NM_001007536) Human Over-expression Lysate
LY423503 100 µg

AKR1CL1 (AKR1C8P) (NM_001007536) Human Over-expression Lysate

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), 0.2mg/mL
BNUB0634-500 1x 500 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Appendix
CS711332 5x 5 µm

Tissue FFPE Sections, Appendix

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB605512 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
HRP Conjugate Stabilizer, Mammalian, 1X
6706 500 mL

HRP Conjugate Stabilizer, Mammalian, 1X

Sign In for Pricing
View Details
Human WDR25 activation kit by CRISPRa
GA112447 1 Kit

Human WDR25 activation kit by CRISPRa

Sign In for Pricing
View Details