Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irgc1 Peptide - N-terminal region

Irgc1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

F630044M05Rik, Gm1102, Gm474, Iigp5, Irgc

UniProt

Q8C262

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Irgc1 Rabbit Polyclonal Antibody (orb326191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_950178

Preservative

Lyophilized powder

AA Sequence

RGLGAEDPGAALTGVVETTMQPSPYPHPQFPDVTLWDLPGAGSPGCSADK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human N-Cadherin, C-His Tag
HA211124-01 Inquire

Human N-Cadherin, C-His Tag

Sign In for Pricing
View Details
Human N-Cadherin, C-His Tag
HA211124-02 100 µg

Human N-Cadherin, C-His Tag

Sign In for Pricing
View Details
Mouse Cdh9 activation kit by CRISPRa
GA200668 1 Kit

Mouse Cdh9 activation kit by CRISPRa

Sign In for Pricing
View Details
Mmp13 Rabbit Polyclonal Antibody
TA362934 100 µL

Mmp13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EverBrite TrueBlack® Hardset Mounting Medium
#23017-T 1x 2 mL

EverBrite TrueBlack® Hardset Mounting Medium

Sign In for Pricing
View Details
VPS36 Rabbit Polyclonal Antibody
TA367365 100 µL

VPS36 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details