Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irgc1 Peptide - N-terminal region

Irgc1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

F630044M05Rik, Gm1102, Gm474, Iigp5, Irgc

UniProt

Q8C262

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Irgc1 Rabbit Polyclonal Antibody (orb326191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_950178

Preservative

Lyophilized powder

AA Sequence

RGLGAEDPGAALTGVVETTMQPSPYPHPQFPDVTLWDLPGAGSPGCSADK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Goat Polyclonal Antibody to Human Lambda (Free & Bound)
FA-2108-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Human Lambda (Free & Bound)

Sign In for Pricing
View Details
uLK2 (NM_001142610) Human Over-expression Lysate
LY428207 100 µg

uLK2 (NM_001142610) Human Over-expression Lysate

Sign In for Pricing
View Details
NOB1 (NM_014062) Human Recombinant Protein
TP309537 20 µg

NOB1 (NM_014062) Human Recombinant Protein

Sign In for Pricing
View Details
5-Amino-1-naphthalenesulfonamide Hydrochloride
TRC-A618350-250MG 250 mg

5-Amino-1-naphthalenesulfonamide Hydrochloride

Sign In for Pricing
View Details
Mouse Timeless activation kit by CRISPRa
GA204351 1 Kit

Mouse Timeless activation kit by CRISPRa

Sign In for Pricing
View Details
APC Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997UE-01 25 µg

APC Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details