Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irx2 Peptide - C-terminal region

Irx2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IRX6, MGC103290

UniProt

P81066

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Irx2 Rabbit Polyclonal Antibody (orb576200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034704

Preservative

Lyophilized powder

AA Sequence

GETLHAMPKAASDTGKAGSHSLESHYRPPGGGYEPKKDTSEGCAVVGAGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF19 (NM_001077511) Human Over-expression Lysate
LY421454 100 µg

TCF19 (NM_001077511) Human Over-expression Lysate

Sign In for Pricing
View Details
Egln3 (BC022961) Mouse Tagged ORF Clone
MG200563 10 µg

Egln3 (BC022961) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Clotiazepam-13C,d3
TRC-C587412-1MG 1 mg

Clotiazepam-13C,d3

Sign In for Pricing
View Details
Ezrin (Ab-478) Antibody
8B8031-AAT 50 µg

Ezrin (Ab-478) Antibody

Sign In for Pricing
View Details
NCOA4 Rabbit Polyclonal Antibody
TA370239 100 µL

NCOA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Cox8a activation kit by CRISPRa
GA200847 1 Kit

Mouse Cox8a activation kit by CRISPRa

Sign In for Pricing
View Details