Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irx2 Peptide - C-terminal region

Irx2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IRX6, MGC103290

UniProt

P81066

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Irx2 Rabbit Polyclonal Antibody (orb576200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034704

Preservative

Lyophilized powder

AA Sequence

GETLHAMPKAASDTGKAGSHSLESHYRPPGGGYEPKKDTSEGCAVVGAGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orbi-Shaker™XL orbital shaker with flat mat platform, 115V
BT1011 1 Each

Orbi-Shaker™XL orbital shaker with flat mat platform, 115V

Sign In for Pricing
View Details
Clic4 Mouse Gene Knockout Kit (CRISPR)
KN503461 1 Kit

Clic4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SH2D5 activation kit by CRISPRa
GA118284 1 Kit

Human SH2D5 activation kit by CRISPRa

Sign In for Pricing
View Details
Azido-peg8-nhs Ester (~90%)
TRC-A965580-10MG 10 mg

Azido-peg8-nhs Ester (~90%)

Sign In for Pricing
View Details
Dysadherin (FXYD5) (NM_001164605) Human Over-expression Lysate
LC431776 20 µg

Dysadherin (FXYD5) (NM_001164605) Human Over-expression Lysate

Sign In for Pricing
View Details
ELAVL2 (NM_001171195) Human Over-expression Lysate
LC432918 20 µg

ELAVL2 (NM_001171195) Human Over-expression Lysate

Sign In for Pricing
View Details