Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irx2 Peptide - middle region

Irx2 Peptide - middle region

Product Specifications

Product Name Alternative

IRX6, MGC103290

UniProt

P81066

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Irx2 Rabbit Polyclonal Antibody (orb576201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034704

Preservative

Lyophilized powder

AA Sequence

RRLKKENKMTWAPRNKSEDEDEDEGDASRSKEESSDKAQDGTETSAEDEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Alpha-1D adrenergic receptor (ADRA1D) ELISA Kit
MBS7201713-01 48 Well

Porcine Alpha-1D adrenergic receptor (ADRA1D) ELISA Kit

Sign In for Pricing
View Details
Porcine Alpha-1D adrenergic receptor (ADRA1D) ELISA Kit
MBS7201713-02 96 Well

Porcine Alpha-1D adrenergic receptor (ADRA1D) ELISA Kit

Sign In for Pricing
View Details
Porcine Alpha-1D adrenergic receptor (ADRA1D) ELISA Kit
MBS7201713-03 5x 96 Well

Porcine Alpha-1D adrenergic receptor (ADRA1D) ELISA Kit

Sign In for Pricing
View Details
Porcine Alpha-1D adrenergic receptor (ADRA1D) ELISA Kit
MBS7201713-04 10x 96 Well

Porcine Alpha-1D adrenergic receptor (ADRA1D) ELISA Kit

Sign In for Pricing
View Details
Mmu-miR-6336 miRNA Antagomir
orb1912579-01 10 nmol

Mmu-miR-6336 miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-6336 miRNA Antagomir
orb1912579-02 20 nmol

Mmu-miR-6336 miRNA Antagomir

Sign In for Pricing
View Details