Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irx2 Peptide - middle region

Irx2 Peptide - middle region

Product Specifications

Product Name Alternative

IRX6, MGC103290

UniProt

P81066

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Irx2 Rabbit Polyclonal Antibody (orb576201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034704

Preservative

Lyophilized powder

AA Sequence

RRLKKENKMTWAPRNKSEDEDEDEGDASRSKEESSDKAQDGTETSAEDEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CEBP beta (Thr188 + Thr235) Rabbit pAb, AP conjugated
orb2827676 100 µL

Phospho-CEBP beta (Thr188 + Thr235) Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Mouse Nhp2 qPCR Primer Pair
QM26650S 200 Tests

Mouse Nhp2 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human KCNC1 shRNA (UAS) - Lentiviral human KCNC1 shRNA (UAS, GFP) (100)
GTR15101913 1 Vial

Lentiviral human KCNC1 shRNA (UAS) - Lentiviral human KCNC1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TTF1 Antibody
MBS9609147-01 0.1 mL

TTF1 Antibody

Sign In for Pricing
View Details
TTF1 Antibody
MBS9609147-02 0.2 mL

TTF1 Antibody

Sign In for Pricing
View Details
TTF1 Antibody
MBS9609147-03 5x 0.2 mL

TTF1 Antibody

Sign In for Pricing
View Details