Irx6 Peptide - middle region
Irx6 Peptide - middle region
Product Specifications
Product Name Alternative
RGD1564830
UniProt
D4A7R4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Irx6 Rabbit Polyclonal Antibody (orb580170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001095883
Preservative
Lyophilized powder
AA Sequence
RLKKENKMTWVPKNKGGEERKADGGGEDALGCLNGDTKDATASQEAQGLQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
127531-PE 100 µL
GRB7 (Growth Factor Receptor-bound Protein 7, B47, Epidermal Growth Factor Receptor GRB-7, GRB7 Adapter Protein) (PE)
Sign In for Pricing
View Details 
orb2868397 100 µL
Phospho-eIF4EBP1 (Thr36) Rabbit pAb, BF700 conjugated
Sign In for Pricing
View Details 
C2446-79E-01 50 µg
CD106 (CD106 Antigen, INCAM 100, INCAM-100, L1CAM, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1)
Sign In for Pricing
View Details C2446-79E-02 500 µg
CD106 (CD106 Antigen, INCAM 100, INCAM-100, L1CAM, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1)
Sign In for Pricing
View Details