Irx6 Peptide - middle region
Irx6 Peptide - middle region
Product Specifications
Product Name Alternative
RGD1564830
UniProt
D4A7R4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Irx6 Rabbit Polyclonal Antibody (orb580170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001095883
Preservative
Lyophilized powder
AA Sequence
RLKKENKMTWVPKNKGGEERKADGGGEDALGCLNGDTKDATASQEAQGLQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15322294 1 Vial
Lentiviral human PICALM shRNA (UAS) - Lentiviral human PICALM shRNA (UAS) plasmid
Sign In for Pricing
View Details 
MBS1145375-01 0.05 mg (E-Coli)
Recombinant Sarcophaga bullata Ovary-derived ACE interactive factor
Sign In for Pricing
View Details MBS1145375-02 0.2 mg (E-Coli)
Recombinant Sarcophaga bullata Ovary-derived ACE interactive factor
Sign In for Pricing
View Details MBS1145375-03 0.5 mg (E-Coli)
Recombinant Sarcophaga bullata Ovary-derived ACE interactive factor
Sign In for Pricing
View Details MBS1145375-04 0.05 mg (Yeast)
Recombinant Sarcophaga bullata Ovary-derived ACE interactive factor
Sign In for Pricing
View Details MBS1145375-05 0.05 mg (Baculovirus)
Recombinant Sarcophaga bullata Ovary-derived ACE interactive factor
Sign In for Pricing
View Details