Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITFG2 Peptide - middle region

ITFG2 Peptide - middle region

Product Specifications

Product Name Alternative

MDS028

UniProt

Q969R8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITFG2 Rabbit Polyclonal Antibody (orb585445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060933

Preservative

Lyophilized powder

AA Sequence

EGQVDSLSVTLGPLGLPELMVSQPGCAYAILLCTWKKDTGSPPASEGPTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG13 (Phospho-Ser355) Rabbit pAb
MBS8554291-01 0.1 mL

ATG13 (Phospho-Ser355) Rabbit pAb

Sign In for Pricing
View Details
ATG13 (Phospho-Ser355) Rabbit pAb
MBS8554291-02 0.1 mL (AF405L)

ATG13 (Phospho-Ser355) Rabbit pAb

Sign In for Pricing
View Details
ATG13 (Phospho-Ser355) Rabbit pAb
MBS8554291-03 0.1 mL (AF405S)

ATG13 (Phospho-Ser355) Rabbit pAb

Sign In for Pricing
View Details
ATG13 (Phospho-Ser355) Rabbit pAb
MBS8554291-04 0.1 mL (AF610)

ATG13 (Phospho-Ser355) Rabbit pAb

Sign In for Pricing
View Details
ATG13 (Phospho-Ser355) Rabbit pAb
MBS8554291-05 0.1 mL (AF635)

ATG13 (Phospho-Ser355) Rabbit pAb

Sign In for Pricing
View Details
ATG13 (Phospho-Ser355) Rabbit pAb
MBS8554291-06 0.1 mL (APC)

ATG13 (Phospho-Ser355) Rabbit pAb

Sign In for Pricing
View Details