Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Itgb1 Peptide - C-terminal region

Itgb1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4633401G24Rik, AA409975, AA960159, CD29, Fnrb, gpIIa, Gm9863, ENSMUSG00000051907

UniProt

P09055

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Itgb1 Rabbit Polyclonal Antibody (orb584134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_034708

Preservative

Lyophilized powder

AA Sequence

PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100287896 Mouse Monoclonal Antibody [Clone ID: OTI3H8]
CF808260 100 µg

LOC100287896 Mouse Monoclonal Antibody [Clone ID: OTI3H8]

Sign In for Pricing
View Details
RAB21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G3]
TA505719AM 100 µL

RAB21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G3]

Sign In for Pricing
View Details
CAmLG Human Gene Knockout Kit (CRISPR)
KN418292 1 Kit

CAmLG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FCRLB (NM_001002901) Human Over-expression Lysate
LY400392 100 µg

FCRLB (NM_001002901) Human Over-expression Lysate

Sign In for Pricing
View Details
FBXL11 (KDM2A) Rabbit Polyclonal Antibody
AP11064PU-N 400 µL

FBXL11 (KDM2A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QuantiChrom™ Copper Assay Kit
DICU-250 250 Tests

QuantiChrom™ Copper Assay Kit

Sign In for Pricing
View Details