Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Itgb1 Peptide - C-terminal region

Itgb1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4633401G24Rik, AA409975, AA960159, CD29, Fnrb, gpIIa, Gm9863, ENSMUSG00000051907

UniProt

P09055

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Itgb1 Rabbit Polyclonal Antibody (orb584134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_034708

Preservative

Lyophilized powder

AA Sequence

PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluoroimide
TRC-F591953-1G 1 g

Fluoroimide

Sign In for Pricing
View Details
(S)-Phenylephrine Hydrochloride
TRC-P320630-250MG 250 mg

(S)-Phenylephrine Hydrochloride

Sign In for Pricing
View Details
DYNLT2 Rabbit Polyclonal Antibody
TA369563 100 µL

DYNLT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
8-Channel manifold
MW9600-8CM 1 Each

8-Channel manifold

Sign In for Pricing
View Details
Bend3 Mouse Gene Knockout Kit (CRISPR)
KN502133 1 Kit

Bend3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBE2N Human Gene Knockout Kit (CRISPR)
KN401792 1 Kit

UBE2N Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details