Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITLN1 Peptide - middle region

ITLN1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20022, HL-1, HL1, INTL, ITLN, LFR, hIntL, omentin

UniProt

Q8WWA0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITLN1 Rabbit Polyclonal Antibody (orb578137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060095

Preservative

Lyophilized powder

AA Sequence

WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abat (NM_031003) Rat Untagged Clone
RN209133 10 µg

Abat (NM_031003) Rat Untagged Clone

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)
MBS2055759-01 0.1 mL

PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)
MBS2055759-02 0.2 mL

PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)
MBS2055759-03 0.5 mL

PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)
MBS2055759-04 1 mL

PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)
MBS2055759-05 5 mL

PE-Linked Polyclonal Antibody to Elastase 1, Pancreatic (ELA1)

Sign In for Pricing
View Details