ITLN1 Peptide - middle region
ITLN1 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ20022, HL-1, HL1, INTL, ITLN, LFR, hIntL, omentin
UniProt
Q8WWA0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ITLN1 Rabbit Polyclonal Antibody (orb578137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060095
Preservative
Lyophilized powder
AA Sequence
WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1109301-01 0.02 mg (E-Coli)
Recombinant Chlamydomonas reinhardtii Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details MBS1109301-02 0.1 mg (E-Coli)
Recombinant Chlamydomonas reinhardtii Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details MBS1109301-03 0.02 mg (Yeast)
Recombinant Chlamydomonas reinhardtii Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details MBS1109301-04 0.1 mg (Yeast)
Recombinant Chlamydomonas reinhardtii Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details