Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITM2C Peptide - middle region

ITM2C Peptide - middle region

Product Specifications

Product Name Alternative

BRI3, BRICD2C, E25, E25C, ITM3

UniProt

Q9NQX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITM2C Rabbit Polyclonal Antibody (orb579233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112188

Preservative

Lyophilized powder

AA Sequence

EDSLSSQVRTQMELEEDVKIYLDENYERINVPVPQFGGGDPADIIHDFQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pulmonary surfactant-associated protein B (SFTPB) Canine ELISA Kit
G5136 96 Tests

Pulmonary surfactant-associated protein B (SFTPB) Canine ELISA Kit

Sign In for Pricing
View Details
Anti-CD48 Antibody (4Q564)
TMAY-01167-01 20 µL

Anti-CD48 Antibody (4Q564)

Sign In for Pricing
View Details
Anti-CD48 Antibody (4Q564)
TMAY-01167-02 100 µL

Anti-CD48 Antibody (4Q564)

Sign In for Pricing
View Details
IDH1 Inhibitor 2
MBS3842884-01 1 mg

IDH1 Inhibitor 2

Sign In for Pricing
View Details
IDH1 Inhibitor 2
MBS3842884-02 5 mg

IDH1 Inhibitor 2

Sign In for Pricing
View Details
IDH1 Inhibitor 2
MBS3842884-03 10 mg

IDH1 Inhibitor 2

Sign In for Pricing
View Details