ITM2C Peptide - middle region
ITM2C Peptide - middle region
Product Specifications
Product Name Alternative
BRI3, BRICD2C, E25, E25C, ITM3
UniProt
Q9NQX7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ITM2C Rabbit Polyclonal Antibody (orb579233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112188
Preservative
Lyophilized powder
AA Sequence
EDSLSSQVRTQMELEEDVKIYLDENYERINVPVPQFGGGDPADIIHDFQR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9024819-01 100 mg
(2R,3R)-3-Amino-3-(4-fluoro-phenyl)-2-hydroxy-propionic acid
Sign In for Pricing
View Details MBS9024819-02 5x 100 mg
(2R,3R)-3-Amino-3-(4-fluoro-phenyl)-2-hydroxy-propionic acid
Sign In for Pricing
View Details 
MBS1056731-01 0.02 mg (E-Coli)
Recombinant Shewanella sp. 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
Sign In for Pricing
View Details MBS1056731-02 0.02 mg (Yeast)
Recombinant Shewanella sp. 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
Sign In for Pricing
View Details MBS1056731-03 0.1 mg (E-Coli)
Recombinant Shewanella sp. 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
Sign In for Pricing
View Details