Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JDP2 Peptide - N-terminal region

JDP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

JUNDM2

UniProt

Q8WYK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JDP2 Rabbit Polyclonal Antibody (orb573841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_569736

Preservative

Lyophilized powder

AA Sequence

LPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 10 Antibody
8C0151-AAT 50 µg

Claudin 10 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS634853 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
CXCR3 Recombinant Rabbit monoclonal Antibody
HA750422 100 µL

CXCR3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), 1mg/mL
BNUM2366-50 1x 50 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), 1mg/mL

Sign In for Pricing
View Details
Recombinant Human CD3d/CD3 delta Protein (Fc&FLAG Tag)
PKSH031321 100 µg

Recombinant Human CD3d/CD3 delta Protein (Fc&FLAG Tag)

Sign In for Pricing
View Details
SYNC Mouse Monoclonal Antibody [Clone ID: OTI5B8]
CF809588 100 µg

SYNC Mouse Monoclonal Antibody [Clone ID: OTI5B8]

Sign In for Pricing
View Details