Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JDP2 Peptide - N-terminal region

JDP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

JUNDM2

UniProt

Q8WYK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JDP2 Rabbit Polyclonal Antibody (orb573841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_569736

Preservative

Lyophilized powder

AA Sequence

LPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USO1 Recombinant Rabbit Monoclonal Antibody [JE64-48]
HA721060 100 µL

USO1 Recombinant Rabbit Monoclonal Antibody [JE64-48]

Sign In for Pricing
View Details
ATF 4 (ATF4) Human Gene Knockout Kit (CRISPR)
KN402333 1 Kit

ATF 4 (ATF4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPACA4 (NM_133498) Human Recombinant Protein
TP308285M 100 µg

SPACA4 (NM_133498) Human Recombinant Protein

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), CF568 conjugate, 0.1mg/mL
BNC683085-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
13(S)-HODE
TRC-H669563-1MG 1 mg

13(S)-HODE

Sign In for Pricing
View Details
TMTC2 Human qPCR Primer Pair (NM_152588)
HP217823 200 Reactions

TMTC2 Human qPCR Primer Pair (NM_152588)

Sign In for Pricing
View Details