Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jmjd8 Peptide - C-terminal region

Jmjd8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610003J06Rik

UniProt

Q3TA59

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Jmjd8 Rabbit Polyclonal Antibody (orb583915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082377

Preservative

Lyophilized powder

AA Sequence

PAYSFGIAGAGSGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin B2, gamma1 (BSA & Azide Free) discontinued
L1227-10X-ML750 100 µL

Laminin B2, gamma1 (BSA & Azide Free) discontinued

Sign In for Pricing
View Details
HNRNPH1 Rabbit Polyclonal Antibody
orb2954247-01 50 µg

HNRNPH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNRNPH1 Rabbit Polyclonal Antibody
orb2954247-02 100 µg

HNRNPH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Teflon Comb 13 well 1.5 mm - ABDOS
E12333 1 Unit/Pack

Teflon Comb 13 well 1.5 mm - ABDOS

Sign In for Pricing
View Details
ST 101 (ZSET1446) 200mg
A13764-200 200 mg

ST 101 (ZSET1446) 200mg

Sign In for Pricing
View Details
GPC6 Antibody
MBS7128998-01 0.05 mL

GPC6 Antibody

Sign In for Pricing
View Details