Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jundm2 Peptide - N-terminal region

Jundm2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Jdp2, Jundp2, TIF, Jundm2

UniProt

P97875

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Jundm2 Rabbit Polyclonal Antibody (orb324697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112149

Preservative

Lyophilized powder

AA Sequence

MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD48 Protein, C-His & AVI-tagged, Biotinylated
IMP-1354 20 µg

Recombinant Human CD48 Protein, C-His & AVI-tagged, Biotinylated

Sign In for Pricing
View Details
POLE3 Adenovirus (Mouse)
37155054 1.0 mL

POLE3 Adenovirus (Mouse)

Sign In for Pricing
View Details
Biochanin A (Standard)
HY-14595R-01 5 mg

Biochanin A (Standard)

Sign In for Pricing
View Details
Biochanin A (Standard)
HY-14595R-02 10 mg

Biochanin A (Standard)

Sign In for Pricing
View Details
Biochanin A (Standard)
HY-14595R-03 25 mg

Biochanin A (Standard)

Sign In for Pricing
View Details
Biochanin A (Standard)
HY-14595R-04 50 mg

Biochanin A (Standard)

Sign In for Pricing
View Details