Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jundm2 Peptide - N-terminal region

Jundm2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Jdp2, Jundp2, TIF, Jundm2

UniProt

P97875

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Jundm2 Rabbit Polyclonal Antibody (orb324697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112149

Preservative

Lyophilized powder

AA Sequence

MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Jejuni tig Protein (aa 1-444) (strain 81-176)
VAng-Ly2461-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni tig Protein (aa 1-444) (strain 81-176)

Sign In for Pricing
View Details
Ataxin 3 (ATXN3) (NM_001164780) Human Tagged ORF Clone
RG228117 10 µg

Ataxin 3 (ATXN3) (NM_001164780) Human Tagged ORF Clone

Sign In for Pricing
View Details
CASS4 Rabbit Polyclonal Antibody (FITC)
orb2101716 100 µL

CASS4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MR1 siRNA (Rat)
CRR0455-01 15 nmol

MR1 siRNA (Rat)

Sign In for Pricing
View Details
MR1 siRNA (Rat)
CRR0455-02 30 nmol

MR1 siRNA (Rat)

Sign In for Pricing
View Details
RXR alpha (Retinoid X Receptor alpha, Retinoic Acid Receptor RXRalpha, RXRa, RXRalpha1, FLJ16020, FLJ16733, MGC102720, Nuclear Receptor Subfamily 2 Group B Member 1, NR2B1) (FITC) discontinued
R9985-02C-FITC 100 µL

RXR alpha (Retinoid X Receptor alpha, Retinoic Acid Receptor RXRalpha, RXRa, RXRalpha1, FLJ16020, FLJ16733, MGC102720, Nuclear Receptor Subfamily 2 Group B Member 1, NR2B1) (FITC) discontinued

Sign In for Pricing
View Details