Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KANK2 Peptide - C-terminal region

KANK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANKRD25, DKFZp434N161, FLJ20004, KIAA1518, MGC119707, MXRA3, SIP

UniProt

Q63ZY3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KANK2 Rabbit Polyclonal Antibody (orb585383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056308

Preservative

Lyophilized powder

AA Sequence

DSGVCKVDKQNRAGYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK4 (MAP2K4) Rabbit Polyclonal Antibody
AP02660PU-N 100 µL

MEK4 (MAP2K4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNIP4 Antibody
KC-17354-01 50 μL

KCNIP4 Antibody

Sign In for Pricing
View Details
KCNIP4 Antibody
KC-17354-02 100 µL

KCNIP4 Antibody

Sign In for Pricing
View Details
KCNIP4 Antibody
KC-17354-03 1 mL

KCNIP4 Antibody

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody
KC-3843-01 50 μL

Repulsive guidance molecule A Antibody

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody
KC-3843-02 100 µL

Repulsive guidance molecule A Antibody

Sign In for Pricing
View Details