Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Katna1 Peptide - C-terminal region

Katna1 Peptide - C-terminal region

Product Specifications

UniProt

Q9WV86

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Katna1 Rabbit Polyclonal Antibody (orb581647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035965

Preservative

Lyophilized powder

AA Sequence

DDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Actin related protein 2/3 complex subunit 5 (ARPC5) ELISA kit
GTR10421769 96 Well

Bovine Actin related protein 2/3 complex subunit 5 (ARPC5) ELISA kit

Sign In for Pricing
View Details
Arhgap28 3'UTR GFP Stable Cell Line
TU250838 1.0 mL

Arhgap28 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Thymidine phosphorylase (deoA)
MBS1150339-01 0.02 mg (E-Coli)

Recombinant Salmonella gallinarum Thymidine phosphorylase (deoA)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Thymidine phosphorylase (deoA)
MBS1150339-02 0.02 mg (Yeast)

Recombinant Salmonella gallinarum Thymidine phosphorylase (deoA)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Thymidine phosphorylase (deoA)
MBS1150339-03 0.1 mg (E-Coli)

Recombinant Salmonella gallinarum Thymidine phosphorylase (deoA)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Thymidine phosphorylase (deoA)
MBS1150339-04 0.1 mg (Yeast)

Recombinant Salmonella gallinarum Thymidine phosphorylase (deoA)

Sign In for Pricing
View Details