Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Katna1 Peptide - C-terminal region

Katna1 Peptide - C-terminal region

Product Specifications

UniProt

Q9WV86

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Katna1 Rabbit Polyclonal Antibody (orb581647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035965

Preservative

Lyophilized powder

AA Sequence

DDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCB Antibody
A61460-50UG 50 µg

FANCB Antibody

Sign In for Pricing
View Details
CD13 Antibody
R35348-100UG 100 µg

CD13 Antibody

Sign In for Pricing
View Details
Porcine Endothelial Protein C Receptor ELISA kit
GTR10407320 96 Well

Porcine Endothelial Protein C Receptor ELISA kit

Sign In for Pricing
View Details
PTPMT1 (B-3)
sc-390901 200 µg/mL

PTPMT1 (B-3)

Sign In for Pricing
View Details
CHRM1 Rabbit Polyclonal Antibody
54298-01 50 µL

CHRM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHRM1 Rabbit Polyclonal Antibody
54298-02 100 µL

CHRM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details