Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD8 Peptide - N-terminal region

KBTBD8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ57592, KIAA1842, TA-KRP

UniProt

Q8NFY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KBTBD8 Rabbit Polyclonal Antibody (orb584629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115894

Preservative

Lyophilized powder

AA Sequence

CHRNVLAAISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAYTSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti Streptolysin O Antibody (IgM) ELISA Kit
MBS7254902-01 48 Strip Well

Rat Anti Streptolysin O Antibody (IgM) ELISA Kit

Sign In for Pricing
View Details
Rat Anti Streptolysin O Antibody (IgM) ELISA Kit
MBS7254902-02 96 Strip Well

Rat Anti Streptolysin O Antibody (IgM) ELISA Kit

Sign In for Pricing
View Details
Rat Anti Streptolysin O Antibody (IgM) ELISA Kit
MBS7254902-03 5x 96 Strip Well

Rat Anti Streptolysin O Antibody (IgM) ELISA Kit

Sign In for Pricing
View Details
Rat Anti Streptolysin O Antibody (IgM) ELISA Kit
MBS7254902-04 10x 96 Strip Well

Rat Anti Streptolysin O Antibody (IgM) ELISA Kit

Sign In for Pricing
View Details
Recombinant Shigella Sonnei nagB Protein (aa 1-266)
VAng-Lsx09932-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei nagB Protein (aa 1-266)

Sign In for Pricing
View Details
RAB31 Rabbit Polyclonal Antibody (FITC)
orb464757 100 µL

RAB31 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details