Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD8 Peptide - N-terminal region

KBTBD8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ57592, KIAA1842, TA-KRP

UniProt

Q8NFY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KBTBD8 Rabbit Polyclonal Antibody (orb584629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115894

Preservative

Lyophilized powder

AA Sequence

CHRNVLAAISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAYTSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTdCPU
C06944-25mg 25 mg

BTdCPU

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae argE Protein (aa 1-383)
VAng-Cr4651-500gEcoli 500 µg (E. coli)

Recombinant Klebsiella Pneumoniae argE Protein (aa 1-383)

Sign In for Pricing
View Details
Asparagine Synthetase Rabbit mAb Antibody
orb3015986 100 µL

Asparagine Synthetase Rabbit mAb Antibody

Sign In for Pricing
View Details
Rabbit Dermal Hair Papilla Primary Cells
CC7F771 5x 10^5 Cells/Vial

Rabbit Dermal Hair Papilla Primary Cells

Sign In for Pricing
View Details
3-amino-4,5,6,7-tetrahydro-1h-indazole hcl
BFC04330-01 0.5 g

3-amino-4,5,6,7-tetrahydro-1h-indazole hcl

Sign In for Pricing
View Details
3-amino-4,5,6,7-tetrahydro-1h-indazole hcl
BFC04330-02 5 g

3-amino-4,5,6,7-tetrahydro-1h-indazole hcl

Sign In for Pricing
View Details