Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnd1 Peptide - N-terminal region

Kcnd1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110037K09Rik, Kca2-1, Kv4.1, Shal, mShal1

UniProt

Q03719

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnd1 Rabbit Polyclonal Antibody (orb575391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032449

Preservative

Lyophilized powder

AA Sequence

MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit
MBS9397614-01 48 Well

Sheep B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit

Sign In for Pricing
View Details
Sheep B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit
MBS9397614-02 96 Well

Sheep B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit

Sign In for Pricing
View Details
Sheep B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit
MBS9397614-03 5x 96 Well

Sheep B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit

Sign In for Pricing
View Details
Sheep B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit
MBS9397614-04 10x 96 Well

Sheep B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit

Sign In for Pricing
View Details
Alpk1 3'UTR Luciferase Stable Cell Line
TU200551 1.0 mL

Alpk1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Pulmonary Great Artery Endothelial Cell Complete Medium
CM-H002-01 100 mL

Human Pulmonary Great Artery Endothelial Cell Complete Medium

Sign In for Pricing
View Details