Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnd1 Peptide - N-terminal region

Kcnd1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110037K09Rik, Kca2-1, Kv4.1, Shal, mShal1

UniProt

Q03719

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnd1 Rabbit Polyclonal Antibody (orb575391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032449

Preservative

Lyophilized powder

AA Sequence

MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1159 (NM_001000871) Rat Tagged ORF Clone Lentiviral Particle
RR207291L4V 200 µL

Olr1159 (NM_001000871) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Protein L1/L1R, Vaccinia virus (sf9, His, myc)
HY-P72301-01 2 µg

Protein L1/L1R, Vaccinia virus (sf9, His, myc)

Sign In for Pricing
View Details
Protein L1/L1R, Vaccinia virus (sf9, His, myc)
HY-P72301-02 10 µg

Protein L1/L1R, Vaccinia virus (sf9, His, myc)

Sign In for Pricing
View Details
Protein L1/L1R, Vaccinia virus (sf9, His, myc)
HY-P72301-03 50 µg

Protein L1/L1R, Vaccinia virus (sf9, His, myc)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana ABC transporter G family member 20 (ABCG20)
orb2908479-01 20 µg

Recombinant Arabidopsis thaliana ABC transporter G family member 20 (ABCG20)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana ABC transporter G family member 20 (ABCG20)
orb2908479-02 100 µg

Recombinant Arabidopsis thaliana ABC transporter G family member 20 (ABCG20)

Sign In for Pricing
View Details