Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh2 Peptide - C-terminal region

Kcnh2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI326795, ERG1, LQT, Lqt2, M-erg, Merg1, merg1a, merg1b

UniProt

O35219

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnh2 Rabbit Polyclonal Antibody (orb575321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038597

Preservative

Lyophilized powder

AA Sequence

RRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Nitrosopyrrolidine-2-carboxylic Acid
TRC-N497885-25MG 25 mg

1-Nitrosopyrrolidine-2-carboxylic Acid

Sign In for Pricing
View Details
HS6ST2 Antibody
KC-43153-01 50 μL

HS6ST2 Antibody

Sign In for Pricing
View Details
HS6ST2 Antibody
KC-43153-02 100 µL

HS6ST2 Antibody

Sign In for Pricing
View Details
HS6ST2 Antibody
KC-43153-03 1 mL

HS6ST2 Antibody

Sign In for Pricing
View Details
Human JMJD6 activation kit by CRISPRa
GA108127 1 Kit

Human JMJD6 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Syndecan 1 (SDC1) ELISA Kit
RDR-SDC1-Mu-01 96 Tests

Mouse Syndecan 1 (SDC1) ELISA Kit

Sign In for Pricing
View Details